I am new to coding and writing a shell script which searches for motifs in protein sequence files and prints their location if present.
But these motifs have degenerate positions.
For example,
A motif can be (psi, psi,x, psi) where psi=(I, L or V) and x can be any of the 20 amino acids.
I would search a set of sequences for the occurrence of this motif. However, my protein sequences are exact sequences, i.e. they have no ambiguity, like:
>
MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGL
Would like the search for the all possible exact instances of the motif in the protein sequence which is present in fasta file.
I have a rough code which I know is wrong.
#!/usr/bin/bash
x=(A C G H I L M P S T V D E F K N Q R W Y)
psi=(I L V)
alpha=(D E)
motif1=($psi,$psi,$x,$psi)
for f in *.fasta ; do
if grep -q "$motif1" <$f ; then
echo $f
grep "^>" $f | tr -d ">"
grep -v ">" $f | grep -aob "$motif1"
fi
done
Appreciate any help in finding my way.
Thanks in advance!
The shell is an excellent tool for orchestrating other tools, but it's not particularly well suited to analyzing the contents of files.
A common arrangement is to use the shell to run Awk over a set of files, and do the detection logic in Awk instead. (Other popular tools are Python and Perl; I would perhaps tackle this in Python if I were to start from scratch.)
Regardless of the language of your script, you should avoid code duplication; refactor to put parameters in variables and then run the code with those parameters, or perhaps move the functionality to a function and then call it with different parameters. For example,
scan () {
local f
for f in *.fasta; do
# Inefficient: refactor to do the grep only once, then decide whether you want to show the output or not
if grep -q "$1" "$f"; then
# Always, always use double quotes around file names
echo "$f"
grep "^>" "$f" | tr -d ">"
grep -v ">" "$f" | grep -aob "$1"
fi
done
}
case $motif in
1) scan "$SIM_Type_1";; # Notice typo in variable name
2) scan "$SIM_Type_2";; # Ditto
3) scan "$SIM_Type_3";; # Ditto
4) scan "$SIM_Type_4";; # Ditto
5) scan "$SIM_TYPE_5";; # Notice inconsistent variable name
alpha) scan "$SIM_Type_alpha";;
beta) scan "$SIM_Type_beta";;
esac
You are declaring the _*Type_* variables (or occasionally *_TYPE_* -- the shell is case sensitive, and you should probably use the same capitalization for all the variables just to make it easier for yourself) as arrays, but then you are apparently attempting to use them as regular scalars. I can only guess as to what you intend for the variables to actually contain; but I'm guessing you want something like
# These are strings which contain regular expressions
x='[ACGHILMPSTVDEFKNQRWY]'
psi='[ILV]'
psi_1='[IV]'
alpha='[DE]'
# These are strings which contain sequences of the above regexes
# The ${variable} braces are not strictly necessary, but IMHO help legibility
SIM_Type_1="${psi}${psi}${x}${psi}"
SIM_Type_2="${psi}${x}${psi}${psi}"
SIM_Type_3="${psi}${psi}${psi}${psi}"
SIM_Type_4="${x}${psi}${x}${psi}"
SIM_TYPE_5="${psi}${alpha}${psi}${alpha}${psi}"
SIM_Type_alpha="${psi_1}${x}${psi_1}${psi}"
SIM_Type_beta="${psi_1}${psi_1}.${x}${psi}"
# You had an empty spot here ^ I guessed you want to permit any character?
If you really wanted these to be arrays, the way to access the contents of the array is "${array[#]}" but then that will not produce something we can directly pass to grep or Awk so I went with declaring these as strings containing regular expressions for the motifs.
But to reiterate, Awk is probably a better language for this, so let's refactor scan to be an Awk script.
# This replaces the function definition above
scan () {
awk -v re="$1" '{ if (/^>/) label=$0
else if (idx = match($0, re, result) {
if (! printed) { print FILENAME; printed = 1 }
print len + idx ":" result[0]
}
len += 1+length($0) # one for the newline
}
# Reset printed if we skip to a new file
FNR == 1 { printed = 0 }' *.fasta
}
The main complication here is reimplementing the grep -b byte offset calculation. If that is not strictly necessary (perhaps a line number would suffice?) then the Awk script can be reduced to a somewhat more trivial one.
Your use of grep -a suggests that perhaps your input files contain DOS newlines. I think this will work fine regardless of this.
The immediate benefit of this refactoring is that we avoid scanning the potentially large input file twice. We only scan the file once, and print the file name on the first match.
If you want to make the script more versatile, this is probably also a better starting point than the grep | tr solution you had before. But if the script does what you need, and the matches are often near the beginning of the input file, or the input files are not large, perhaps you don't actually want to switch to Awk after all.
Notice also that like your grep logic, this will not work if a sequence is split over several lines in the FASTA file and the match happens to straddle one of the line breaks.
Finally, making the script prompt for interactive input is a design wart. I would suggest you accept the user choice as a command-line argument instead.
motif=$1
So you'd use this as ./scriptname alpha to run the alpha regex against your FASTA files.
Another possible refactoring would be to read all the motif regexs into a slightly more complex Awk script and print all matches for all of them in a form which then lets you easily pick the ones you actually want to examine in more detail. If you have a lot of data to process, looping over it only once is a huge win.
Related
I am trying to delete the last three lines of a file in a shell bash script.
Since I am using local variables in combination with the Regex syntax in sed the answer proposed in How to use sed to remove the last n lines of a file does not cover this case. On the contrary, the cases covered deal with sed in a terminal and does not cover syntax in shell scripts, neither does it cover the use of variables in sed expressions.
The commands I have available is limited, since I am not on a Linux but use a MINGW64 for it.
sed does a create job so far, but deleting the last three lines gives me some headaches in relation of how to format the expression.
I use wc to be aware of how many lines the file has and subtract then with expr three lines.
n=$(wc -l < "$distribution_area")
rel=$(expr $n - 3)
The start point for deleting lines is defined by rel but accessing the local variable happens through the $ and unfortunately the syntax of sed is using the $ to define the end of file. Hence,
sed -i "$rel,$d" "$distribution_area"
won't work, and what ever variant of combinations e.g. '"'"$rel"'",$d' gives me sed: -e expression #1, char 1: unknown command: `"' or something similar.
Can somebody show me how to combine the variable with the $d regex syntax of sed?
sed -i "$rel,$d" "$distribution_area"
Here you're missing the variable name (n) for the second arg.
Consider the following example on a file called test that contains 1-10:
n=$(wc -l < test)
rel=$(($n - 3))
sed "$rel,$n d" test
Result:
1
2
3
4
5
6
To make sure the d will not interfere with the $n, you can add a space instead of escaping.
If you have a recent head available, I'd recommend something like:
head -n -3 test
Can somebody show me how to combine the variable with the $d regex syntax of sed?
$d expands to a varibale d, you have to escape it.
"$rel,\$d"
or:
"$rel"',$d'
But I would use:
head -n -3 "$distribution_area" > "$distribution_area".tmp
mv "$distribution_area".tmp "$distribution_area"
You can remove the last N lines using only pure Bash, without forking additional processes (such as sed). Such scripts look ugly, but they would work in any environment where only Bash runs and nothing else is available, no other binaries like sed, awk etc.
If the entire file fits in RAM, a straightforward solution is to split it by lines and print all but the N trailing ones:
delete_last_n_lines() {
local -ir n="$1"
local -a lines
readarray lines
((${#lines[#]} > n)) || return 0
printf '%s' "${lines[#]::${#lines[#]} - n}"
}
If the file does not fit in RAM, you can keep a FIFO buffer that stores N lines (N + 1 in the “implementation” below, but that’s just a technical detail), let the file (arbitrarily large) flow through the buffer and, after reaching the end of the file, not print out what remains in the buffer (the last N lines to remove).
delete_last_n_lines() {
local -ir n="$1 + 1"
local -a lines
local -i pos i
for ((i = 0; i < n; ++i)); do
IFS= read -r lines[i] || return 0
done
printf '%s\n' "${lines[pos]}"
while IFS= read -r lines[pos++]; do
((pos %= n))
printf '%s\n' "${lines[pos]}"
done
}
The following example gets 10 lines of input, 0 to 9, but prints out only 0 to 6, removing 7, 8 and 9 as desired:
printf '%s' {0..9}$'\n' | delete_last_n_lines 3
Last but not least, this simple hack lacks sed’s -i option to edit files in-place. That could be implemented (e.g.) using a temporary file to store the output and then renaming the temporary file to the original. (A more sophisticated approach would be needed to avoid storing the temporary copy altogether. I don’t think Bash exposes an interface like lseek() to read files “backwards”, so this cannot be done in Bash alone.)
I currently use long piped bash commands to extract data from text files like this, where $f is my file:
result=$(grep "entry t $t " $f | cut -d ' ' -f 5,19 | \
sort -nk2 | tail -n 1 | cut -d ' ' -f 1)
I use a script that might do hundreds of similar searches of $f ,sorting selected lines in various ways depending on what I'm pulling out. I like one-line bash strings with a bunch of pipes because its compact and easy, but it can take forever. Can anyone suggest a faster alternative? Maybe something that loads the whole file into memory first?
Thanks
You might get a boost with doing the whole pipe with gawk or another awk that has asorti by doing:
contents="$(cat "$f")"
result="$(awk -vpattern="entry t $t" '$0 ~ pattern {matches[$5]=$19} END {asorti(matches,inds); print inds[1]}' <<<"$contents")"
This will read "$f" into a variable then we'll use a single awk command (well, gawk anyway) to do all the rest of the work. Here's how that works:
-vpattern="entry t $t": defines an awk variable named pattern that contains the shell variable t
$0 ~ pattern matches the current line against the pattern, if it matches we'll do the part in the braces, otherwise we skip it
matches[$5]=$19 adds an entry to an array (and creates the array if needed) where the key is the 5th field and the value is the 19th
END do the following function after all the input has been processed
asorti(matches,inds) sort the entries of matches such that the inds is an array holding the order of the keys in matches to get the values in sorted order
print inds[1] prints the index in matches (i.e., a $5 from before) associated with the lowest 19th field
<<<"$contents" have awk work on the value in the shell variable contents as though it were a file it was reading
Then you can just update the pattern for each, not have to read the file from disk each time and not need so many extra processes for all the pipes.
You'll have to benchmark to see if it's really faster or not though, and if performance is important you really should think about moving to a "proper" language instead of shell scripting.
Since you haven't provided sample input/output this is just a guess and I only post it because there's other answers already posted that you should not do, so - this may be what you want instead of that one line:
result=$(awk -v t="$t" '
BEGIN { regexp = "entry t " t " " }
$0 ~ regexp {
if ( ($6 > maxKey) || (maxKey == "") ) {
maxKey = $6
maxVal = $5
}
}
END { print maxVal }
' "$f")
I suspect your real performance issue, however, isn't that script but that you are running it and maybe others inside a loop that you haven't shown us. If so, see why-is-using-a-shell-loop-to-process-text-considered-bad-practice and post a better example so we can help you.
This is my first time posting on here so bear with me please.
I received a bash assignment but my professor is completely unhelpful and so are his notes.
Our assignment is to filter and print out palindromes from a file. In this case, the directory is:
/usr/share/dict/words
The word lengths range from 3 to 45 and are supposed to only filter lowercase letters (the dictionary given has characters and uppercases, as well as lowercase letters). i.e. "-dkas-das" so something like "q-evvavve-q" may count as a palindrome but i shouldn't be getting that as a proper result.
Anyways, I can get it to filter out x amount of words and return (not filtering only lowercase though).
grep "^...$" /usr/share/dict/words |
grep "\(.\).\1"
And I can use subsequent lines for 5 letter words and 7 and so on:
grep "^.....$" /usr/share/dict/words |
grep "\(.\)\(.\).\2\1"
But the prof does not want that. We are supposed to use a loop. I get the concept but I don't know the syntax, and like I said, the notes are very unhelpful.
What I tried was setting variables x=... and y=.. and in a while loop, having x=$x$y but that didn't work (syntax error) and neither did x+=..
Any help is appreciated. Even getting my non-lowercase letters filtered out.
Thanks!
EDIT:
If you're providing a solution or a hint to a solution, the simplest method is prefered.
Preferably one that uses 2 grep statements and a loop.
Thanks again.
Like this:
for word in `grep -E '^[a-z]{3,45}$' /usr/share/dict/words`;
do [ $word == `echo $word | rev` ] && echo $word;
done;
Output using my dictionary:
aha
bib
bob
boob
...
wow
Update
As pointed out in the comments, reading in most of the dictionary into a variable in the for loop might not be the most efficient, and risks triggering errors in some shells. Here's an updated version:
grep -E '^[a-z]{3,45}$' /usr/share/dict/words | while read -r word;
do [ $word == `echo $word | rev` ] && echo $word;
done;
Why use grep? Bash will happily do that for you:
#!/bin/bash
is_pal() {
local w=$1
while (( ${#w} > 1 )); do
[[ ${w:0:1} = ${w: -1} ]] || return 1
w=${w:1:-1}
done
}
while read word; do
is_pal "$word" && echo "$word"
done
Save this as banana, chmod +x banana and enjoy:
./banana < /usr/share/dict/words
If you only want to keep the words with at least three characters:
grep ... /usr/share/dict/words | ./banana
If you only want to keep the words that only contain lowercase and have at least three letters:
grep '^[[:lower:]]\{3,\}$' /usr/share/dict/words | ./banana
The multiple greps are wasteful. You can simply do
grep -E '^([a-z])[a-z]\1$' /usr/share/dict/words
in one fell swoop, and similarly, put the expressions on grep's standard input like this:
echo '^([a-z])[a-z]\1$
^([a-z])([a-z])\2\1$
^([a-z])([a-z])[a-z]\2\1$' | grep -E -f - /usr/share/dict/words
However, regular grep does not permit backreferences beyond \9. With grep -P you can use double-digit backreferences, too.
The following script constructs the entire expression in a loop. Unfortunately, grep -P does not allow for the -f option, so we build a big thumpin' variable to hold the pattern. Then we can actually also simplify to a single pattern of the form ^(.)(?:.|(.)(?:.|(.)....\3)?\2?\1$, except we use [a-z] instead of . to restrict to just lowercase.
head=''
tail=''
for i in $(seq 1 22); do
head="$head([a-z])(?:[a-z]|"
tail="\\$i${tail:+)?}$tail"
done
grep -P "^${head%|})?$tail$" /usr/share/dict/words
The single grep should be a lot faster than individually invoking grep 22 or 43 times on the large input file. If you want to sort by length, just add that as a filter at the end of the pipeline; it should still be way faster than multiple passes over the entire dictionary.
The expression ${tail+:)?} evaluates to a closing parenthesis and question mark only when tail is non-empty, which is a convenient way to force the \1 back-reference to be non-optional. Somewhat similarly, ${head%|} trims the final alternation operator from the ultimate value of $head.
Ok here is something to get you started:
I suggest to use the plan you have above, just generate the number of "." using a for loop.
This question will explain how to make a for loop from 3 to 45:
How do I iterate over a range of numbers defined by variables in Bash?
for i in {3..45};
do
* put your code above here *
done
Now you just need to figure out how to make "i" number of dots "." in your first grep and you are done.
Also, look into sed, it can nuke the non-lowercase answers for you..
Another solution that uses a Perl-compatible regular expressions (PCRE) with recursion, heavily inspired by this answer:
grep -P '^(?:([a-z])(?=[a-z]*(\1(?(2)\2))$))++[a-z]?\2?$' /usr/share/dict/words
Straight to the point, I'm wondering how to use grep/find/sed/awk to match a certain string (that ends with a number) and increment that number by 1. The closest I've come is to concatenate a 1 to the end (which works well enough) because the main point is to simply change the value. Here's what I'm currently doing:
find . -type f | xargs sed -i 's/\(\?cache_version\=[0-9]\+\)/\11/g'
Since I couldn't figure out how to increment the number, I captured the whole thing and just appended a "1". Before, I had something like this:
find . -type f | xargs sed -i 's/\?cache_version\=\([0-9]\+\)/?cache_version=\11/g'
So at least I understand how to capture what I need.
Instead of explaining what this is for, I'll just explain what I want it to do. It should find text in any file, recursively, based on the current directory (isn't important, it could be any directory, so I'd configure that later), that matches "?cache_version=" with a number. It will then increment that number and replace it in the file.
Currently the stuff I have above works, it's just that I can't increment that found number at the end. It would be nicer to be able to increment instead of appending a "1" so that the future values wouldn't be "11", "111", "1111", "11111", and so on.
I've gone through dozens of articles/explanations, and often enough, the suggestion is to use awk, but I cannot for the life of me mix them. The closest I came to using awk, which doesn't actually replace anything, is:
grep -Pro '(?<=\?cache_version=)[0-9]+' . | awk -F: '{ print "match is", $2+1 }'
I'm wondering if there's some way to pipe a sed at the end and pass the original file name so that sed can have the file name and incremented number (from the awk), or whatever it needs that xargs has.
Technically, this number has no importance; this replacement is mainly to make sure there is a new number there, 100% for sure different than the last. So as I was writing this question, I realized I might as well use the system time - seconds since epoch (the technique often used by AJAX to eliminate caching for subsequent "identical" requests). I ended up with this, and it seems perfect:
CXREPLACETIME=`date +%s`; find . -type f | xargs sed -i "s/\(\?cache_version\=\)[0-9]\+/\1$CXREPLACETIME/g"
(I store the value first so all files get the same value, in case it spans multiple seconds for whatever reason)
But I would still love to know the original question, on incrementing a matched number. I'm guessing an easy solution would be to make it a bash script, but still, I thought there would be an easier way than looping through every file recursively and checking its contents for a match then replacing, since it's simply incrementing a matched number...not much else logic. I just don't want to write to any other files or something like that - it should do it in place, like sed does with the "i" option.
I think finding file isn't the difficult part for you. I therefore just go to the point, to do the +1 calculation. If you have gnu sed, it could be done in this way:
sed -r 's/(.*)(\?cache_version=)([0-9]+)(.*)/echo "\1\2$((\3+1))\4"/ge' file
let's take an example:
kent$ cat test
ello
barbaz?cache_version=3fooooo
bye
kent$ sed -r 's/(.*)(\?cache_version=)([0-9]+)(.*)/echo "\1\2$((\3+1))\4"/ge' test
ello
barbaz?cache_version=4fooooo
bye
you could add -i option if you like.
edit
/e allows you to pass matched part to external command, and do substitution with the execution result. Gnu sed only.
see this example: external command/tool echo, bc are used
kent$ echo "result:3*3"|sed -r 's/(result:)(.*)/echo \1$(echo "\2"\|bc)/ge'
gives output:
result:9
you could use other powerful external command, like cut, sed (again), awk...
Pure sed version:
This version has no dependencies on other commands or environment variables.
It uses explicit carrying. For carry I use the # symbol, but another name can be used if you like. Use something that is not present in your input file.
First it finds SEARCHSTRING<number> and appends a # to it.
It repeats incrementing digits that have a pending carry (that is, have a carry symbol after it: [0-9]#)
If 9 was incremented, this increment yields a carry itself, and the process will repeat until there are no more pending carries.
Finally, carries that were yielded but not added to a digit yet are replaced by 1.
sed "s/SEARCHSTRING[0-9]*[0-9]/&#/g;:a {s/0#/1/g;s/1#/2/g;s/2#/3/g;s/3#/4/g;s/4#/5/g;s/5#/6/g;s/6#/7/g;s/7#/8/g;s/8#/9/g;s/9#/#0/g;t a};s/#/1/g" numbers.txt
This perl command will search all files in current directory (without traverse it, you will need File::Find module or similar for that more complex task) and will increment the number of a line that matches cache_version=. It uses the /e flag of the regular expression that evaluates the replacement part.
perl -i.bak -lpe 'BEGIN { sub inc { my ($num) = #_; ++$num } } s/(cache_version=)(\d+)/$1 . (inc($2))/eg' *
I tested it with file in current directory with following data:
hello
cache_version=3
bye
It backups original file (ls -1):
file
file.bak
And file now with:
hello
cache_version=4
bye
I hope it can be useful for what you are looking for.
UPDATE to use File::Find for traversing directories. It accepts * as argument but will discard them with those found with File::Find. The directory to begin the search is the current of execution of the script. It is hardcoded in the line find( \&wanted, "." ).
perl -MFile::Find -i.bak -lpe '
BEGIN {
sub inc {
my ($num) = #_;
++$num
}
sub wanted {
if ( -f && ! -l ) {
push #ARGV, $File::Find::name;
}
}
#ARGV = ();
find( \&wanted, "." );
}
s/(cache_version=)(\d+)/$1 . (inc($2))/eg
' *
This is ugly (I'm a little rusty), but here's a start using sed:
orig="something1" ;
text=`echo $orig | sed "s/\([^0-9]*\)\([0-9]*\)/\1/"` ;
num=`echo $orig | sed "s/\([^0-9]*\)\([0-9]*\)/\2/"` ;
echo $text$(($num + 1))
With an original filename ($orig) of "something1", sed splits off the text and numeric portions into $text and $num, then these are combined in the final section with an incremented number, resulting in something2.
Just a start since it doesn't consider cases with numbers within the file name or names with no number at the end, but hopefully helps with your original goal of using sed.
This can actually be simplified within sed by using buffers, I believe (sed can operate recursively), but I'm really rusty with that aspect of it.
perl -pi -e 's/(\?cache_version=)(\d+)/$1.($2+1)/ge' FILE [FILE...]
or for a complete solution:
find . -type f | xargs perl -pi -e 's/(\?cache_version=)(\d+)/$1.($2+1)/ge'
perl substitution operator
/e modifier evaluates the replacement as if it were a Perl statement, using its return value as the replacement text.
. operator concatenates strings in Perl. The parentheses ensures that the arithmetic operation $2+1 takes precedence over concatenation.
/g modifier applies substitution to all matched strings within line
perl options
-p ensures that perl will execute the command on every line of each file
-i ensures that each file will be edited inplace
-e specifies the perl command(s) that are executed (in this case, the substitution operation)
Is there a simple way to remove duplicate contents from a large textfile? It would be great to be able to detect duplicate sentences (as separated by "." or even better to find duplicates of sentence fragments (such as 4-word pieces of text).
Removing duplicate words is easy enough, as other people have pointed out. Anything more complicated than that, and you're into Natural Language Processing territory. Bash isn't the best tool for that -- you need a slightly more elegant weapon for a civilized age.
Personally, I recommend Python and it's NLTK (natural language toolkit). Before you dive into that, it's probably worth reading up a little bit on NLP so that you know what you actually need to do. For example, the "4-word pieces of text" are known as 4-grams (n-grams in the generic case) in the literature. The toolkit will help you find those, and more.
Of course, there are probably alternatives to Python/NLTK, but I'm not familiar with any.
Remove duplicate phrases an keeping the original order:
nl -w 8 "$infile" | sort -k2 -u | sort -n | cut -f2
The first stage of the pipeline prepends every line with line number to document the original order. The second stage sorts the original data with the unique switch set.
The third restores the original order (sorting the 1. column). The final cut removes the first column.
You can remove duplicate lines (which have to be exactly equal) with uniq if you sort your textfile first.
$ cat foo.txt
foo
bar
quux
foo
baz
bar
$ sort foo.txt
bar
bar
baz
foo
foo
quux
$ sort foo.txt | uniq
bar
baz
foo
quux
Apart from that, there's no simple way of doing what you want. (How will you even split sentences?)
You can use grep with backreferences.
If you write grep "\([[:alpha:]]*\)[[:space:]]*\1" -o <filename> it will match any two identical words following one another. I.e. if the file content is this is the the test file , it will output the the.
(Explanation [[:alpha:]] matches any character a-z and A-Z, the asterisk * after it means that may appear as many times as it wants, the \(\) is used for grouping to backreference it later, then [[:space:]]* matches any number of spaces and tabs, and finally \1 matches the exact sequence that was found, that was enclosed in \(\)brackets)
Likewise, if you want to match a group of 4 words, that is repeated two times in a row, the expression will look like grep "\(\([[:alpha:]]*[[:space]]*\)\{4\}[[:space:]]*\1" -o <filename> - it will match e.g. a b c d a b c d.
Now we need to add an arbitrary character sequence inbetween matches. In theory this should be done with inserting .* just before backreference, i.e. grep "\(\([[:alpha:]]*[[:space]]*\)\{4\}.*\1" -o <filename>, but this doesn't seem to work for me - it matches just any string and ignores said backreference
The short answer is that there's no easy method. In general any solution needs to first decide how to split the input document into chunks (sentences, sets of 4 words each, etc) and then compare them to find duplicates. If it's important that the ordering of the non-duplicate elements by the same in the output as it was in the input then this only complicates matters further.
The simplest bash-friendly solution would be to split the input into lines based on whatever criteria you choose (e.g. split on each ., although doing this quote-safely is a bit tricky) and then use standard duplicate detection mechanisms (e.g. | uniq -c | sort -n | sed -E -ne '/^[[:space:]]+1/!{s/^[[:space:]]+[0-9]+ //;p;}' and then, for each resulting line, remote the text from the input.
Presuming that you had a file that was properly split into lines per "sentence" then
uniq -c lines_of_input_file | sort -n | sed -E -ne '/^[[:space:]]+1/!{s/^[[:space:]]+[0-9]+ //;p;}' | while IFS= read -r match ; do sed -i '' -e 's/'"$match"'//g' input_file ; done
Might be sufficient. Of course it will break horribly if the $match contains any data which sed interprets as a pattern. Another mechanism should be employed to perform the actual replacement if this is an issue for you.
Note: If you're using GNU sed the -E switch above should be changed to -r
I just created a script in python, that does pretty much what I wanted originally:
import string
import sys
def find_all(a_str, sub):
start = 0
while True:
start = a_str.find(sub, start)
if start == -1: return
yield start
start += len(sub)
if len(sys.argv) != 2:
sys.exit("Usage: find_duplicate_fragments.py some_textfile.txt")
file=sys.argv[1]
infile=open(file,"r")
text=infile.read()
text=text.replace('\n','') # remove newlines
table = string.maketrans("","")
text=text.translate(table, string.punctuation) # remove punctuation characters
text=text.translate(table, string.digits) # remove numbers
text=text.upper() # to uppercase
while text.find(" ")>-1:
text=text.replace(" "," ") # strip double-spaces
spaces=list(find_all(text," ")) # find all spaces
# scan through the whole text in packets of four words
# and check for multiple appearances.
for i in range(0,len(spaces)-4):
searchfor=text[spaces[i]+1:spaces[i+4]]
duplist=list(find_all(text[spaces[i+4]:len(text)],searchfor))
if len(duplist)>0:
print len(duplist),': ',searchfor
BTW: I'm a python newbie, so any hints on better python practise are welcome!