I am trying to delete the last three lines of a file in a shell bash script.
Since I am using local variables in combination with the Regex syntax in sed the answer proposed in How to use sed to remove the last n lines of a file does not cover this case. On the contrary, the cases covered deal with sed in a terminal and does not cover syntax in shell scripts, neither does it cover the use of variables in sed expressions.
The commands I have available is limited, since I am not on a Linux but use a MINGW64 for it.
sed does a create job so far, but deleting the last three lines gives me some headaches in relation of how to format the expression.
I use wc to be aware of how many lines the file has and subtract then with expr three lines.
n=$(wc -l < "$distribution_area")
rel=$(expr $n - 3)
The start point for deleting lines is defined by rel but accessing the local variable happens through the $ and unfortunately the syntax of sed is using the $ to define the end of file. Hence,
sed -i "$rel,$d" "$distribution_area"
won't work, and what ever variant of combinations e.g. '"'"$rel"'",$d' gives me sed: -e expression #1, char 1: unknown command: `"' or something similar.
Can somebody show me how to combine the variable with the $d regex syntax of sed?
sed -i "$rel,$d" "$distribution_area"
Here you're missing the variable name (n) for the second arg.
Consider the following example on a file called test that contains 1-10:
n=$(wc -l < test)
rel=$(($n - 3))
sed "$rel,$n d" test
Result:
1
2
3
4
5
6
To make sure the d will not interfere with the $n, you can add a space instead of escaping.
If you have a recent head available, I'd recommend something like:
head -n -3 test
Can somebody show me how to combine the variable with the $d regex syntax of sed?
$d expands to a varibale d, you have to escape it.
"$rel,\$d"
or:
"$rel"',$d'
But I would use:
head -n -3 "$distribution_area" > "$distribution_area".tmp
mv "$distribution_area".tmp "$distribution_area"
You can remove the last N lines using only pure Bash, without forking additional processes (such as sed). Such scripts look ugly, but they would work in any environment where only Bash runs and nothing else is available, no other binaries like sed, awk etc.
If the entire file fits in RAM, a straightforward solution is to split it by lines and print all but the N trailing ones:
delete_last_n_lines() {
local -ir n="$1"
local -a lines
readarray lines
((${#lines[#]} > n)) || return 0
printf '%s' "${lines[#]::${#lines[#]} - n}"
}
If the file does not fit in RAM, you can keep a FIFO buffer that stores N lines (N + 1 in the “implementation” below, but that’s just a technical detail), let the file (arbitrarily large) flow through the buffer and, after reaching the end of the file, not print out what remains in the buffer (the last N lines to remove).
delete_last_n_lines() {
local -ir n="$1 + 1"
local -a lines
local -i pos i
for ((i = 0; i < n; ++i)); do
IFS= read -r lines[i] || return 0
done
printf '%s\n' "${lines[pos]}"
while IFS= read -r lines[pos++]; do
((pos %= n))
printf '%s\n' "${lines[pos]}"
done
}
The following example gets 10 lines of input, 0 to 9, but prints out only 0 to 6, removing 7, 8 and 9 as desired:
printf '%s' {0..9}$'\n' | delete_last_n_lines 3
Last but not least, this simple hack lacks sed’s -i option to edit files in-place. That could be implemented (e.g.) using a temporary file to store the output and then renaming the temporary file to the original. (A more sophisticated approach would be needed to avoid storing the temporary copy altogether. I don’t think Bash exposes an interface like lseek() to read files “backwards”, so this cannot be done in Bash alone.)
Related
I have a small script which basically generates a menu of all the scripts in my ~/scripts folder and next to each of them displays a sentence describing it, that sentence being the third line within the script commented out. I then plan to pipe this into fzf or dmenu to select it and start editing it or whatever.
1 #!/bin/bash
2
3 # a script to do
So it would look something like this
foo.sh a script to do X
bar.sh a script to do Y
Currently I have it run a for loop over all the files in the scripts folder and then run sed -n 3p on all of them.
for i in $(ls -1 ~/scripts); do
echo -n "$i"
sed -n 3p "~/scripts/$i"
echo
done | column -t -s '#' | ...
I was wondering if there is a more efficient way of doing this that did not involve a for loop and only used sed. Any help will be appreciated. Thanks!
Instead of a loop that is parsing ls output + sed, you may try this awk command:
awk 'FNR == 3 {
f = FILENAME; sub(/^.*\//, "", f); print f, $0; nextfile
}' ~/scripts/* | column -t -s '#' | ...
Yes there is a more efficient way, but no, it doesn't only use sed. This is probably a silly optimization for your use case though, but it may be worthwhile nonetheless.
The inefficiency is that you're using ls to read the directory and then parse its output. For large directories, that causes lots of overhead for keeping that list in memory even though you only traverse it once. Also, it's not done correctly, consider filenames with special characters that the shell interprets.
The more efficient way is to use find in combination with its -exec option, which starts a second program with each found file in turn.
BTW: If you didn't rely on line numbers but maybe a tag to mark the description, you could also use grep -r, which avoids an additional process per file altogether.
This might work for you (GNU sed):
sed -sn '1h;3{H;g;s/\n/ /p}' ~/scripts/*
Use the -s option to reset the line number addresses for each file.
Copy line 1 to the hold space.
Append line 3 to the hold space.
Swap the hold space for the pattern space.
Replace the newline with a space and print the result.
All files in the directory ~/scripts will be processed.
N.B. You may wish to replace the space delimiter by a tab or pipe the results to the column command.
I have a text file which looks like this
1
bbbbb
aaa
END
2
ttttt
mmmm
uu
END
3
....
END
The number of lines between the single number patterns (1,2,3) and END is variable. So the upper delimiting pattern changes, but the final one does not. Using some bash commands, I would like to grep lines between a specified upper partner and the corresponding END, for example a command that takes as input 2 and returns
2
ttttt
mmmm
uu
END
I've tried various solutions with sed and awk, but still can't figure it out. The main problem is that I may need to grep a entry in the middle of the file, so I can't use sed with /pattern/q...Any help will be greatly appreciated!
With awk we set a flag f when matching the start pattern, which is an input argument. After that row, the flag is on and it prints every line. When reaching "END" (AND the flag is on!) it exits.
awk -v p=2 '$0~p{f=1} f{print} f&&/END/{exit}' file
Use sed and its addresses to only print a part of the file between the patterns:
#!/bin/bash
start=x
while [[ $start = *[^0-9]* ]] ; do
read -p 'Enter the start pattern: ' start
done
sed -n "/^$start$/,/^END$/p" file
You can use the sed with an address range. Modify the first regular expression (RE1) in /RE1/,/RE2/ as your convenience:
sed -n '/^[[:space:]]*2$/,/^[[:space:]]*END$/p' file
Or,
sed '
/^[[:space:]]*2$/,/^[[:space:]]*END$/!d
/^[[:space:]]*END$/q
' file
This quits upon reading the END, thus may be more efficient.
Another option/solution using just bash
#!/usr/bin/env bash
start=$1
while IFS= read -r lines; do
if [[ ${lines##* } == $start ]]; then
print=on
elif [[ ${lines##* } == [0-9] ]]; then
print=off
fi
case $print in on) printf '%s\n' "$lines";; esac
done < file.txt
Run the script with the number as the argument, 1 can 2 or 3 or ...
./myscript 1
This might work for you (GNU sed):
sed -n '/^\s*2$/{:a;N;/^\s*END$/M!ba;p;q}' file
Switch off implicit printing by setting the -n option.
Gather up the lines beginning with a line starting with 2 and ending in a line starting with END, print the collection and quit.
N.B. The second regexp uses the M flag, which allows the ^ and $ to match start and end of lines when multiple lines are being matched. Another thing to bear in mind is that using a range i.e. sed -n '/start/,/end/p' file, will start printing lines the moment the first condition is met and if the second match does not materialise, it will continue printing to the end of the file.
I am trying to export characters from a reference file in which their byte position is known. To do this, I have a long list of numbers stored as a variable which have been used as the input to a tail command.
For example, the reference file looks like:
ggaaatgcattcaaacatgc
And the list looks like:
5
10
7
15
I have tried using this code:
list=$(<pos.txt)
echo "$list"
cat ref.txt | tail -c +"list" | head -c1 > out.txt
However, it keeps returning "invalid number of bytes: '+5\n10\n7\n15...'"
My expected output would be
a
t
g
a
...
Can anybody tell me what I'm doing wrong? Thanks!
It looks like you are trying to access your list variable in your tail command. You can access it like this: $list rather than just using quotes around it.
Your logic is flawed even after fixing the variable access. The list variable includes all lines of your list.txt file. Including the newline character \n which is invisible in many UIs and programs, but it is of course visible when you are manually reading single bytes. You need to feed the lines one by one to make it work properly.
Also unless those numbers are indexes from the end, you need to feed them to head instead of tail.
If I understood what you are attempting to do correctly, this should work:
while read line
do
head -c $line ref.txt | tail -c 1 >> out.txt
done < pos.txt
The reason for your command failure is simple. The variable list contains a multi-line string stored from the pos.txt files including newlines. You cannot pass not more than one integer value for the -c flag.
Your attempts can be fixed quite easily with removing calls to cat and using a temporary variable to hold the file content
while IFS= read -r lineNo; do
tail -c "$lineNo" ref.txt | head -c1
done < pos.txt
But then if your intentions is print the desired output in a new-line every time, head does not output that way. It just forms a string atga for your given input in a single line and not across multiple lines with one character at each line.
As Gordon mentions in one of the comments, for much more efficient FASTA files processing, you could just use one invocation of awk though (skipping multiple forks to head/tail). Your provided input does not involve any headers to skip which would be straightforward as
awk ' FNR==NR{ n = split($0,arr,""); for(i=1;i<=n;i++) hash[i] = arr[i] }
( $0 in hash ){ print hash[$0] } ' ref.txt pos.txt
You could use cut instead of tail:
pos=$(<pos.txt)
cut -c ${pos//$'\n'/,} --output-delimiter=$'\n' ref.txt
Or just awk:
awk -F '' 'NR==FNR{c[$0];next} {for(i in c) print $i}' pos.txt ref.txt
both yield:
a
g
t
a
I am new to coding and writing a shell script which searches for motifs in protein sequence files and prints their location if present.
But these motifs have degenerate positions.
For example,
A motif can be (psi, psi,x, psi) where psi=(I, L or V) and x can be any of the 20 amino acids.
I would search a set of sequences for the occurrence of this motif. However, my protein sequences are exact sequences, i.e. they have no ambiguity, like:
>
MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGL
Would like the search for the all possible exact instances of the motif in the protein sequence which is present in fasta file.
I have a rough code which I know is wrong.
#!/usr/bin/bash
x=(A C G H I L M P S T V D E F K N Q R W Y)
psi=(I L V)
alpha=(D E)
motif1=($psi,$psi,$x,$psi)
for f in *.fasta ; do
if grep -q "$motif1" <$f ; then
echo $f
grep "^>" $f | tr -d ">"
grep -v ">" $f | grep -aob "$motif1"
fi
done
Appreciate any help in finding my way.
Thanks in advance!
The shell is an excellent tool for orchestrating other tools, but it's not particularly well suited to analyzing the contents of files.
A common arrangement is to use the shell to run Awk over a set of files, and do the detection logic in Awk instead. (Other popular tools are Python and Perl; I would perhaps tackle this in Python if I were to start from scratch.)
Regardless of the language of your script, you should avoid code duplication; refactor to put parameters in variables and then run the code with those parameters, or perhaps move the functionality to a function and then call it with different parameters. For example,
scan () {
local f
for f in *.fasta; do
# Inefficient: refactor to do the grep only once, then decide whether you want to show the output or not
if grep -q "$1" "$f"; then
# Always, always use double quotes around file names
echo "$f"
grep "^>" "$f" | tr -d ">"
grep -v ">" "$f" | grep -aob "$1"
fi
done
}
case $motif in
1) scan "$SIM_Type_1";; # Notice typo in variable name
2) scan "$SIM_Type_2";; # Ditto
3) scan "$SIM_Type_3";; # Ditto
4) scan "$SIM_Type_4";; # Ditto
5) scan "$SIM_TYPE_5";; # Notice inconsistent variable name
alpha) scan "$SIM_Type_alpha";;
beta) scan "$SIM_Type_beta";;
esac
You are declaring the _*Type_* variables (or occasionally *_TYPE_* -- the shell is case sensitive, and you should probably use the same capitalization for all the variables just to make it easier for yourself) as arrays, but then you are apparently attempting to use them as regular scalars. I can only guess as to what you intend for the variables to actually contain; but I'm guessing you want something like
# These are strings which contain regular expressions
x='[ACGHILMPSTVDEFKNQRWY]'
psi='[ILV]'
psi_1='[IV]'
alpha='[DE]'
# These are strings which contain sequences of the above regexes
# The ${variable} braces are not strictly necessary, but IMHO help legibility
SIM_Type_1="${psi}${psi}${x}${psi}"
SIM_Type_2="${psi}${x}${psi}${psi}"
SIM_Type_3="${psi}${psi}${psi}${psi}"
SIM_Type_4="${x}${psi}${x}${psi}"
SIM_TYPE_5="${psi}${alpha}${psi}${alpha}${psi}"
SIM_Type_alpha="${psi_1}${x}${psi_1}${psi}"
SIM_Type_beta="${psi_1}${psi_1}.${x}${psi}"
# You had an empty spot here ^ I guessed you want to permit any character?
If you really wanted these to be arrays, the way to access the contents of the array is "${array[#]}" but then that will not produce something we can directly pass to grep or Awk so I went with declaring these as strings containing regular expressions for the motifs.
But to reiterate, Awk is probably a better language for this, so let's refactor scan to be an Awk script.
# This replaces the function definition above
scan () {
awk -v re="$1" '{ if (/^>/) label=$0
else if (idx = match($0, re, result) {
if (! printed) { print FILENAME; printed = 1 }
print len + idx ":" result[0]
}
len += 1+length($0) # one for the newline
}
# Reset printed if we skip to a new file
FNR == 1 { printed = 0 }' *.fasta
}
The main complication here is reimplementing the grep -b byte offset calculation. If that is not strictly necessary (perhaps a line number would suffice?) then the Awk script can be reduced to a somewhat more trivial one.
Your use of grep -a suggests that perhaps your input files contain DOS newlines. I think this will work fine regardless of this.
The immediate benefit of this refactoring is that we avoid scanning the potentially large input file twice. We only scan the file once, and print the file name on the first match.
If you want to make the script more versatile, this is probably also a better starting point than the grep | tr solution you had before. But if the script does what you need, and the matches are often near the beginning of the input file, or the input files are not large, perhaps you don't actually want to switch to Awk after all.
Notice also that like your grep logic, this will not work if a sequence is split over several lines in the FASTA file and the match happens to straddle one of the line breaks.
Finally, making the script prompt for interactive input is a design wart. I would suggest you accept the user choice as a command-line argument instead.
motif=$1
So you'd use this as ./scriptname alpha to run the alpha regex against your FASTA files.
Another possible refactoring would be to read all the motif regexs into a slightly more complex Awk script and print all matches for all of them in a form which then lets you easily pick the ones you actually want to examine in more detail. If you have a lot of data to process, looping over it only once is a huge win.
I have a file with 2 columns, and i want to use the values from the second column to set the range in the cut command to select a range of characters from another file. The range i desire is the character in the position of the value in the second column plus the next 10 characters. I will give an example in a while.
My files are something like that:
File with 2 columns and no blank lines between lines (file1.txt):
NAME1 10
NAME2 25
NAME3 48
NAME4 66
File that i want to extract the variable range of characters(just one very long line with no spaces and no bold font) (file2.txt):
GATCGAGCGGGATTCTTTTTTTTTAGGCGAGTCAGCTAGCATCAGCTACGAGAGGCGAGGGCGGGCTATCACGACTACGACTACGACTACAGCATCAGCATCAGCGCACTAGAGCGAGGCTAGCTAGCTACGACTACGATCAGCATCGCACATCGACTACGATCAGCATCAGCTACGCATCGAAGAGAGAGC
...or, more literally (for copy/paste to test):
GATCGAGCGGGATTCTTTTTTTTTAGGCGAGTCAGCTAGCATCAGCTACGAGAGGCGAGGGCGGGCTATCACGACTACGACTACGACTACAGCATCAGCATCAGCGCACTAGAGCGAGGCTAGCTAGCTACGACTACGATCAGCATCGCACATCGACTACGATCAGCATCAGCTACGCATCGAAGAGAGAGC
Desired resulting file, one sequence per line (result.txt):
GATTCTTTTT
GGCGAGTCAG
CGAGAGGCGA
TATCACGACT
The resulting file would have the characters from 10-20, 25-35, 48-58 and 66-76, each range in a new line. So, it would always keep the range of 10, but in different start points and those start points are set by the values in the second column from the first file.
I tried the command:
for i in $(awk '{print $2}' file1.txt);
do
p1=$i;
p2=`expr "$1" + 10`
cut -c$p1-$2 file2.txt > result.txt;
done
I don't get any output or error message.
I also tried:
while read line; do
set $line
p2=`expr "$2" + 10`
cut -c$2-$p2 file2.txt > result.txt;
done <file1.txt
This last command gives me an error message:
cut: invalid range with no endpoint: -
Try 'cut --help' for more information.
expr: non-integer argument
There's no need for cut here; dd can do the job of indexing into a file, and reading only the number of bytes you want. (Note that status=none is a GNUism; you may need to leave it out on other platforms and redirect stderr otherwise if you want to suppress informational logging).
while read -r name index _; do
dd if=file2.txt bs=1 skip="$index" count=10 status=none
printf '\n'
done <file1.txt >result.txt
This approach avoids excessive memory requirements (as present when reading the whole of file2 -- assuming it's large), and has bounded performance requirements (overhead is equal to starting one copy of dd per sequence to extract).
Using awk
$ awk 'FNR==NR{a=$0; next} {print substr(a,$2+1,10)}' file2 file1
GATTCTTTTT
GGCGAGTCAG
CGAGAGGCGA
TATCACGACT
If file2.txt is not too large, then you can read it in memory,
and use Bash sub-strings to extract the desired ranges:
data=$(<file2.txt)
while read -r name index _; do
echo "${data:$index:10}"
done <file1.txt >result.txt
This will be much more efficient than running cut or another process for every single range definition.
(Thanks to #CharlesDuffy for the tip to read data without a useless cat, and the while loop.)
One way to solve it:
#!/bin/bash
while read line; do
pos=$(echo "$line" | cut -f2 -d' ')
x=$(head -c $(( $pos + 10 )) file2.txt | tail -c 10)
echo "$x"
done < file1.txt > result.txt
It's not the solution an experienced bash hacker would use, but it is very good for someone who is new to bash. It uses tools that are very versatile, although somewhat bad if you need high performance. Shell scripting is commonly used by people who rarely shell scripts, but knows a few commands and just wants to get the job done. That's why I'm including this solution, even if the other answers are superior for more experienced people.
The first line is pretty easy. It just extracts the numbers from file1.txt. The second line uses the very nice tools head and tail. Usually, they are used with lines instead of characters. Nevertheless, I print the first pos + 10 characters with head. The result is piped into tail which prints the last 10 characters.
Thanks to #CharlesDuffy for improvements.