Related
I have a text file with a large amount of data which is tab delimited. I want to have a look at the data such that I can see the unique values in a column. For example,
Red Ball 1 Sold
Blue Bat 5 OnSale
...............
So, its like the first column has colors, so I want to know how many different unique values are there in that column and I want to be able to do that for each column.
I need to do this in a Linux command line, so probably using some bash script, sed, awk or something.
What if I wanted a count of these unique values as well?
Update: I guess I didn't put the second part clearly enough. What I wanted to do is to have a count of "each" of these unique values not know how many unique values are there. For instance, in the first column I want to know how many Red, Blue, Green etc coloured objects are there.
You can make use of cut, sort and uniq commands as follows:
cat input_file | cut -f 1 | sort | uniq
gets unique values in field 1, replacing 1 by 2 will give you unique values in field 2.
Avoiding UUOC :)
cut -f 1 input_file | sort | uniq
EDIT:
To count the number of unique occurences you can make use of wc command in the chain as:
cut -f 1 input_file | sort | uniq | wc -l
awk -F '\t' '{ a[$1]++ } END { for (n in a) print n, a[n] } ' test.csv
You can use awk, sort & uniq to do this, for example to list all the unique values in the first column
awk < test.txt '{print $1}' | sort | uniq
As posted elsewhere, if you want to count the number of instances of something you can pipe the unique list into wc -l
Assuming the data file is actually Tab separated, not space aligned:
<test.tsv awk '{print $4}' | sort | uniq
Where $4 will be:
$1 - Red
$2 - Ball
$3 - 1
$4 - Sold
# COLUMN is integer column number
# INPUT_FILE is input file name
cut -f ${COLUMN} < ${INPUT_FILE} | sort -u | wc -l
Here is a bash script that fully answers the (revised) original question. That is, given any .tsv file, it provides the synopsis for each of the columns in turn. Apart from bash itself, it only uses standard *ix/Mac tools: sed tr wc cut sort uniq.
#!/bin/bash
# Syntax: $0 filename
# The input is assumed to be a .tsv file
FILE="$1"
cols=$(sed -n 1p $FILE | tr -cd '\t' | wc -c)
cols=$((cols + 2 ))
i=0
for ((i=1; i < $cols; i++))
do
echo Column $i ::
cut -f $i < "$FILE" | sort | uniq -c
echo
done
This script outputs the number of unique values in each column of a given file. It assumes that first line of given file is header line. There is no need for defining number of fields. Simply save the script in a bash file (.sh) and provide the tab delimited file as a parameter to this script.
Code
#!/bin/bash
awk '
(NR==1){
for(fi=1; fi<=NF; fi++)
fname[fi]=$fi;
}
(NR!=1){
for(fi=1; fi<=NF; fi++)
arr[fname[fi]][$fi]++;
}
END{
for(fi=1; fi<=NF; fi++){
out=fname[fi];
for (item in arr[fname[fi]])
out=out"\t"item"_"arr[fname[fi]][item];
print(out);
}
}
' $1
Execution Example:
bash> ./script.sh <path to tab-delimited file>
Output Example
isRef A_15 C_42 G_24 T_18
isCar YEA_10 NO_40 NA_50
isTv FALSE_33 TRUE_66
Using Bash, I'm wanting to get a list of email addresses from a CSV file to do a recursive grep search on it for a bunch of directories looking for a match in specific metadata XML files, and then also tallying up how many results I find for each address throughout the directory tree (i.e. updating the tally field in the same CSV file).
accounts.csv looks something like this:
updated to more accurately reflect real-world data
email,date,bar,URL,"something else",tally
address#somewhere.com,21/04/2015,1.2.3.4,https://blah.com/,"blah blah",5
something#that.com,17/06/2015,5.6.7.8,https://blah.com/,"lah yah",0
another#here.com,7/08/2017,9.10.11.12,https://blah.com/,"wah wah",1
For example, if we put address#somewhere.com in $email from the list, run
grep -rl "${email}" --include=\*_meta.xml --only-matching | wc -l
on it and then add that result to the tally column.
At the moment I can get the first column of that CSV file (minus the heading/first line) using
awk -F"," '{print $1}' accounts.csv | tail -n +2
but I'm lost how to do the looping and also the writing of the result back to the CSV file...
So for instance, with another#here.com if we run
grep -rl "${email}" --include=\*_meta.xml --only-matching | wc -l
and the result is say 17, how can I update that line to become:
another#here.com,7/08/2017,9.10.11.12,https://blah.com/,"wah wah",17
Is this possible with maybe awk or sed?
This is where I'm up to:
#!/bin/bash
# make temporary list of email addresses
awk -F"," '{print $1}' accounts.csv | tail -n +2 > emails.tmp
# loop over each
while read email; do
# count how many uploads for current email address
grep -rl "${email}" --include=\*_meta.xml --only-matching | wc -l
done < emails.tmp
XML Metadata looks something like this:
<?xml version="1.0" encoding="UTF-8"?>
<metadata>
<identifier>SomeTitleNameGoesHere</identifier>
<mediatype>audio</mediatype>
<collection>opensource_movies</collection>
<description>example <br /></description>
<subject>testing</subject>
<title>Some Title Name Goes Here</title>
<uploader>another#here.com</uploader>
<addeddate>2017-05-28 06:20:54</addeddate>
<publicdate>2017-05-28 06:21:15</publicdate>
<curation>[curator]email#address.com[/curator][date]20170528062151[/date][comment]checked for malware[/comment]</curation>
</metadata>
how to do the looping and also the writing of the result back to the CSV file
awk does the looping automatically. You can change any field by assigning to it. So to change a tally field (the 6th in each line) you would do $6 = ....
awk is a great tool for many scenarios. You probably can safe a lot of time in the future by investing some minutes in a short tutorial now.
The only non-trivial part is getting the output of grep into awk.
The following script increments each tally by the count of *_meta.xml files containing the given email address:
awk -F, -v OFS=, -v q=\' 'NR>1 {
cmd = "grep -rlFw " q $1 q " --include=\\*_meta.xml | wc -l";
cmd | getline c;
close(cmd);
$6 = c
} 1' accounts.csv
For simplicity we assume that filenames are free of linebreaks and email addresses are free of '.
To reduce possible false positives, I also added the -F and -w option to your grep command.
-F searches literal strings; without it, searching for a.b#c would give false positives for things like axb#c and a-b#c.
-w matches only whole words; without it, searching for b#c would give a false positive for ab#c. This isn't 100% safe, as a-b#c would still give a false positive, but without knowing more about the structure of your xml files we cannot fix this.
A pipeline to reduce the number of greps:
grep -rHo --include=\*_meta.xml -f <(awk -F, 'NR > 1 {print $1}' accounts.csv) \
| gawk -F, -v OFS=',' '
NR == FNR {
# store the filenames for each email
if (match($0, /^([^:]+):(.+)/, m)) tally[m[2]][m[1]]
next
}
FNR > 1 {$4 = length(tally[$1])}
1
' - accounts.csv
Here is a solution using single awk command to achieve this. This solution will be highly performant as compared to other solutions because it is scanning each XML file only once for all the email addresses found in first column of the CSV file. Also it is not invoking any external command or spawning a sub0shell anywhere.
This should work in any version of awk.
cat srch.awk
# function to escape regex meta characters
function esc(s, tmp) {
tmp = s
gsub(/[&+.]/, "\\\\&", tmp)
return tmp
}
BEGIN {FS=OFS=","}
# while processing csv file
NR == FNR {
# save escaped email address in array em skipping header row
if (FNR > 1)
em[esc($1)] = 0
# save each row in rec array
rec[++n] = $0
next
}
# this block will execute for eaxh XML file
{
# loop each email and save count of matched email in array em
# PS: gsub return no of substitutionx
for (i in em)
em[i] += gsub(i, "&")
}
END {
# print header row
print rec[1]
# from 2nd row onwards split row into columns using comma
for (i=2; i<=n; ++i) {
split(rec[i], a, FS)
# 6th column is the count of occurrence from array em
print a[1], a[2], a[3], a[4], a[5], em[esc(a[1])]
}
}
Use it as:
awk -f srch.awk accounts.csv $(find . -name '*_meta.xml') > tmp && mv tmp accounts.csv
A script that handles accounts.csv line by line and replaces the data in accounts.new.csv for comparison.
#! /bin/bash
file_old=accounts.csv
file_new=${file_old/csv/new.csv}
delimiter=","
x=1
# Copy file
cp ${file_old} ${file_new}
while read -r line; do
# Skip first line
if [[ $x -gt 1 ]]; then
# Read data into variables
IFS=${delimiter} read -r address foo bar tally somethingelse <<< ${line}
cnt=$(find . -name '*_meta.xml' -exec grep -lo "${address}" {} \; | wc -l)
# Reset tally
tally=$cnt
# Change line number $x in new file
sed "${x}s/.*/${address} ${foo} ${bar} ${tally} ${somethingelse}/; ${x}s/ /${delimiter}/g" \
-i ${file_new}
fi
((x++))
done < ${file_old}
The input and ouput:
# Input
$ find . -name '*_meta.xml' -exec cat {} \; | sort | uniq -c
2 address#somewhere.com
1 something#that.com
$ cat accounts.csv
email,foo,bar,tally,somethingelse
address#somewhere.com,bar1,foo2,-1,blah
something#that.com,bar2,foo3,-1,blah
another#here.com,bar4,foo5,-1,blah
# output
$ ./test.sh
$ cat accounts.new.csv
email,foo,bar,tally,somethingelse
address#somewhere.com,bar1,foo2,2,blah
something#that.com,bar2,foo3,1,blah
another#here.com,bar4,foo5,0,blah
MacOS, Unix
So I have a file in the following stockholm format:
# STOCKHOLM 1.0
#=GS WP_002855993.1/5-168 DE [subseq from] MULTISPECIES: AAC(3) family N-acetyltransferase [Campylobacter]
#=GS WP_002856586.1/5-166 DE [subseq from] MULTISPECIES: aminoglycoside N(3)-acetyltransferase [Campylobacter]
WP_002855993.1/5-168 ------LEHNGKKYSDKDLIDAFYQLGIKRGDILCVHTELmkfgKALLT.K...NDFLKTLLECFFKVLGKEGTLLMP-TF---TYSF------CKNE------VYDKVHSKG--KVGVLNEFFRTSGgGVRRTSDPIFSFAVKGAKADIFLKEN--SSCFGKDSVYEILTREGGKFMLLGLNYG-HALTHYAEE-----
#=GR WP_002855993.1/5-168 PP ......6788899999***********************9333344455.6...8999********************.33...3544......4555......799999975..68********98626999****************999865..689*********************9875.456799996.....
WP_002856586.1/5-166 ------LEFENKKYSTYDFIETFYKLGLQKGDTLCVHTEL....FNFGFpLlsrNEFLQTILDCFFEVIGKEGTLIMP-TF---TYSF------CKNE------VYDKINSKT--KMGALNEYFRKQT.GVKRTNDPIFSFAIKGAKEELFLKDT--TSCFGENCVYEVLTKENGKYMTFGGQG--HTLTHYAEE-----
#=GR WP_002856586.1/5-166 PP ......5566677788889999******************....**9953422246679*******************.33...3544......4455......799998876..589**********.******************99999886..689******************999765..5666***96.....
#=GC PP_cons ......6677788899999999*****************9....77675.5...68889*******************.33...3544......4455......799999976..689*******998.8999**************99999876..689******************9998765.466699996.....
#=GC RF xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx....xxxxx.x...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
WP_002855993.1/5-168 -----------------------------------------------------------------------------------------------------
#=GR WP_002855993.1/5-168 PP .....................................................................................................
WP_002856586.1/5-166 -----------------------------------------------------------------------------------------------------
#=GR WP_002856586.1/5-166 PP .....................................................................................................
#=GC PP_cons .....................................................................................................
#=GC RF xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
//
And I've created a script to extract the IDs I want, in this case, WP_002855993.1 and WP_002856586.1, and search through another file to extract DNA sequences with the appropriate IDs. The script is as follows:
#!/bin/bash
for fileName in *.sto;
do
protID=$(grep -o "WP_.\{0,11\}" $fileName | sort | uniq)
echo $protID
file=$(echo $fileName | cut -d '_' -f 1,2,3)
file=$(echo $file'_protein.faa')
echo $file
if [ -n "$protID" ]; then
gawk "/^>/{N=0}/^.*$protID/{N=1} {if(N)print}" $file >>
sequence_protein.file
fi
done
And here's an example of the type of file I'm looking through:
>WP_002855993.1 MULTISPECIES: AAC(3) family N-acetyltransferase [Campylobacter]
MKYFLEHNGKKYSDKDLIDAFYQLGIKRGDILCVHTELMKFGKALLTKNDFLKTLLECFFKVLGKEGTLLMPTFT
>WP_002856586.1 MULTISPECIES: aminoglycoside N(3)-acetyltransferase [Campylobacter]
MKYLLEFENKKYSTYDFIETFYKLGLQKGDTLCVHTELFNFGFPLLSRNEFLQTILDCFFEVIGKEGTLIMPTFT
YSFCKNEVYDKINSKTKMGALNEYFRKQTGVKRTNDPIFSFAIKGAKEELFLKDTTSCFGENCVYEVLTKENGKY
>WP_002856595.1 MULTISPECIES: acetyl-CoA carboxylase biotin carboxylase subunit [Campylobacter]
MNQIHKILIANRAEIAVRVIRACRDLHIKSVAVFTEPDRECLHVKIADEAYRIGTDAIRGYLDVARIVEIAKACG
This script works if I have one ID, but in some cases I get two IDs, and I get an error, because I think it's looking for an ID like "WP_002855993.1 WP_002856586.1". Is there a way to modify this script so it looks for two separate occurrences? I guess it's something with the gawk command, but I'm not sure what exactly. Thanks in advance!
an update to the original script:
#!/usr/bin/env bash
for file_sto in *.sto; do
file_faa=$(echo $file_sto | cut -d '_' -f 1,2,3)
file_faa=${file_faa}"_protein.faa"
awk '(NR==FNR) { match($0,/WP_.\{0,11\}/);
if (RSTART > 0) a[substr($0,RSTART,RLENGTH)]++
next; }
($1 in a){ print RS $0 }' $file_sto RS=">" $file_faa >> sequence_protein.file
done
The awk part can probably even be reduced to :
awk '(NR==FNR) { if ($0 ~ /^WP_/) a[$1]++; next }
($1 in a) { print RS $0 }' FS='/' $file_sto FS=" " RS=">" $file_faa
This awk script does the following:
Set the field separator FS to / and read file $file_sto.
When reading $file_sto the record number NR is the same as the file record number FNR.
(NR==FNR) { if ($0 ~ /^WP_/) a[$1]++; next }: this line works only one $file_sto due to the condition in the front. It checks if the line starts with WP_. If it does, it stores the first field $1 (separated by FS which is a /) in an array a; it then skips to the next record in the file (next).
If we finished reading file $file_sto, we set the field separator back to a single space FS=" " (see section Regular expression) and the record separator RS to > and start reading file $file_faa The latter implies that $0 will contain all lines between > and the first field $1 is the protID.
Reading $file_faa, the file record number FNR is restarted from 1 while NR is not reset. Hence the first awk line is skipped.
($1 in a){ print RS $0 } if the first field is in the array a, print the record with the record separator in front of it.
fixing the original script:
If you want to keep your original script, you could store the protID in a list and then loop the list :
#!/bin/bash
for fileName in *.sto; do
protID_list=( $(grep -o "WP_.\{0,11\}" $fileName | sort | uniq) )
echo ${protID_list[#]}
file=$(echo $fileName | cut -d '_' -f 1,2,3)
file=$(echo $file'_protein.faa')
echo $file
for protID in ${protID_list[#]}; do
if [ -n "$protID" ]; then
gawk "/^>/{N=0}/^.*$protID/{N=1} {if(N)print}" $file >>
sequence_protein.file
fi
done
done
Considering your output file is test.
Using following command gives you only file names:
>>cat text | awk '{print $1}' | grep -R 'WP*' | cut -d":" -f2
gives me output:
WP_002855993.1/5-168
WP_002856586.1/5-166
WP_002855993.1/5-168
WP_002856586.1/5-166
Do you want output like that?
sh noob so be gentle. This a preprocessing exercise using the command line, (I'm on a mac).
I have a large CSV file (original.csv) ~1M rows, 4 cols. I'd like to create processing script that pulls all rows based on a column value, i.e. get all distinct rows. There are 138393 distinct values in column 1. I'm doing the above via awk.
From here I want to take ~half of these found values, shuffle the rows (or randomly select) then split the two groups into two CSV files (file1.csv and file2.csv). FWIW it's for an machine learning exercise so splitting data into test/train.
What's an efficient way to do this? The biggest bottle necks I have now, (probably more I don't see):
Searching for column value match via awk
IO cost from copying rows to separate csv, then going through each csv + appending half values into train.csv and test.csv
Shuffling each file above
...BONUS: Any multithreaded solutions to speed up entire process!
My CSV Data is basic (and sorted by column 1 value already):
1,2,3.5,1112486027
1,29,3.5,1112484676
1,32,3.5,1112484819
1,47,3.5,1112484727
CODE:
#!/bin/bash
DATA_FILE=noheader.csv
awk -F "," '{ print >> ("r"$1".csv"); close("r"$1".csv") }' $DATA_FILE # Creates seperate CSV file for each userID
ID_FILE=unique_ids.txt
if [ -e $ID_FILE ]
then
IDX=$(wc -l unique_ids.txt | awk '{print $1}') # Get count of total rows in CSV
printf "Found %d userIDs \n" $IDX
else
printf "File %s Not Found! \n" "$ID_FILE"
printf "Creating Unique IDs File \n"
cut -d , -f1 $DATA_FILE | sort | uniq > unique_ids.txt
fi
COUNT=0
START=$(date +%s)
for ((i=1; i <= $IDX; i++)) # Iterate through each user CSV file
{
FILE=r${i}.csv
TOT_LNO=$(wc -l $FILE | awk -v FILE="$FILE" '{ print $1; close(FILE) }') # Calc total number of rows in file
SPLT_NO=$(($TOT_LNO / 2)) # ~50% split of user row count for test/train split
gshuf -n $TOT_LNO $FILE # Randomly shuffle rows in csv file
head -n $SPLT_NO $FILE >> train_data.csv
OFFSET=$(($SPLT_NO + 1)) # Appends first line# rows of user{n} ratings to training data
tail -n +$OFFSET $FILE >> test_data.csv # Appends rows nums > line# of user{n} ratings to test data
# awk 'FNR==NR{a[$1];next}($1 in a){print}' file2 file1 # Prints out similarities btwn files (make sure not train/test splipapge)
rm $FILE # Deletes temp user rating files before proceding
((COUNT++))
if ! ((COUNT % 10000))
then
printf "processed %d files!\n" $COUNT
fi
}
END=$(date +%s)
TIME=$((END-START))
printf "processing runtime: %d:\n" $TIME
OUTPUT (assuming it was shuffled):
train.csv
1,2,3.5,1112486027
1,47,3.5,1112484727
test.csv
1,32,3.5,1112484819
1,29,3.5,1112484676
I'm guessing since you didn't provide sample input and expected output that we could test against but it sounds like all you need is:
shuf infile.csv | awk -F, '$1==1{ print > ("outfile" (NR%2)+1 ".csv") }'
If that's not what you want then edit your question to include concise, testable sample input and expected output.
This method below is slightly faster than the accepted awk answer.
Using shuf, GNU split's -n option, and mv:
grep '^1,' noheader.csv | shuf | split -n r/2 ; mv xaa train.csv ; mv xab test.csv
This won't work a Mac, since those use BSD split which has no -n option.
I have a list of CSV files, I have to print a variable name (dynamically; it will change), to last column in the CSV files.
Here is the code:
addProgramtypeID () {
for csv in $1
do
file_name="$csv"
echo $file_name
f=`echo $file_name | cut -d '_' -f3 | cut -d '.' -f1`
echo $f
k=`grep -i $f Program_type.csv | cut -d ',' -f3`
echo $k
awk '{ print $0 "," "'"$k"'" }' "$csv" > tempfile && mv tempfile "$csv"
done
}
addProgramtypeID "T_H_EDCGO.csv"
As of now the variable value K is being printed at the 1st column of the CSV file , also it is removing the first 2 characters of the first column in the file. My requirement is that the variable value should always come as the last column in the CSV file.
input :
TX_ID,SEQUENCE,PROGRAM_ID,CA_ID,C_ID
123,3,334,234,3
545,2,444,456,5
if suppose $k=2
output:
TX_ID,SEQUENCE,PROGRAM_ID,CA_ID,C_ID,2
123,3,334,234,3,2
545,2,444,456,5,2
Program_type.csv
type,desc,id
EDC,Alb,1
EDG,Gsc,2
Assuming there is is nothing nasty in your CSV file, you can use awk as follows:
for csv_file in $ALL_MY_FILES
do
cat csv_file | awk 'BEGIN{FS=","}; {print($(NF))}'
done
Or even just
cat $ALL_MY_FILES | awk 'BEGIN{FS=","}; {print($(NF))}'
Both of these will print the last line column of all the csv files. The results from each CSV are just appended together (is that really what you want?).
The difficulties are on the awk side. This completely unaware of things like quited strings
or extra whitespace. My recommendation is to try the line above, see what goes wrong (if anything) and then start tweaking.
It looks like what you want is just:
$ cat tst.sh
addProgramtypeID () {
csv="$1"
awk -v csv="$csv" '
BEGIN{ FS=OFS=","; split(csv,csvA,/[_.]/); f=csvA[3] }
NR==FNR { if ($0 ~ f) { k = $3 }; next }
{ print $0, k }
' Program_type.csv "$csv" > tempfile && mv tempfile "$csv"
}
addProgramtypeID "T_H_EDC.csv"
$ cat Program_type.csv
type,desc,id
EDC,Alb,1
EDG,Gsc,2
$ cat T_H_EDC.csv
TX_ID,SEQUENCE,PROGRAM_ID,CA_ID,C_ID
123,3,334,234,3
545,2,444,456,5
$ ./tst.sh
$ cat T_H_EDC.csv
TX_ID,SEQUENCE,PROGRAM_ID,CA_ID,C_ID,1
123,3,334,234,3,1
545,2,444,456,5,1
but it's hard to tell since your posted sample input could not produce your posted desired output so I had to make some up.
if ($0 ~ f) should probably just be if ($1 == f), I just copied what your original grep f <file> logic would do.