SocketError: sockaddr resolved to multiple nodename - ruby

Following snippet failing for ruby, removing of this snippet didn't show any error.
I see closed issue https://bugs.ruby-lang.org/issues/15067 , are they same.
Any input on this snippet will be very useful.
platform_is_not :windows do
describe 'using NI_NUMERICHOST as the flag' do
it 'returns an Array containing the numeric hostname and service name' do
Socket.getnameinfo(#addr, Socket::NI_NUMERICHOST).should == [ip_address, 'ftp']
end
end
end
with error
Socket.getnameinfo using IPv4 using a 3 element Array as the first argument using NI_NUMERICHOST as the flag returns an Array containing the numeric hostname and service name ERROR
SocketError: sockaddr resolved to multiple nodename
/home/travis/build/alpha/ruby/spec/ruby/library/socket/socket/getnameinfo_spec.rb:111:in `getnameinfo'
/home/travis/build/alpha/ruby/spec/ruby/library/socket/socket/getnameinfo_spec.rb:111:in `block (6 levels) in <top (required)>'
/home/travis/build/alpha/ruby/spec/ruby/library/socket/socket/getnameinfo_spec.rb:65:in `<top (required)>'

Related

RSpec "Failure/Error: Unable to find matching line from backtrace" On every test

I am working through some Ruby problem sets. I'm using Ubuntu 14.04, rbenv 0.4.0-98-g13a474c, rspec 3.1.4, and ruby 2.0.0p353. I'm running into the following errors for every test I run and I'm hoping someone might be able to guide me in the right direction to a solution.
I have run rspec tests successfully in the past but I can't seem to figure out the issue with my current setup.
Here is the message I receive for every test I run:
6) age is an integer
Failure/Error: Unable to find matching line from backtrace
ArgumentError:
wrong number of arguments (0 for 1)
# /usr/lib/ruby/vendor_ruby/rspec/mocks.rb:10:in `setup'
# /var/lib/gems/1.9.1/gems/rspec-core-3.1.4/lib/rspec/core/mocking_adapters/rspec.rb:19:in `setup_mocks_for_rspec'
# /var/lib/gems/1.9.1/gems/rspec-core-3.1.4/lib/rspec/core/example.rb:366:in `run_before_example'
# /var/lib/gems/1.9.1/gems/rspec-core-3.1.4/lib/rspec/core/example.rb:150:in `block in run'
# /var/lib/gems/1.9.1/gems/rspec-core-3.1.4/lib/rspec/core/example.rb:328:in `with_around_example_hooks'
# /var/lib/gems/1.9.1/gems/rspec-core-3.1.4/lib/rspec/core/example.rb:148:in `run'
# /var/lib/gems/1.9.1/gems/rspec-core-3.1.4/lib/rspec/core/example_group.rb:500:in `block in run_examples'
# /var/lib/gems/1.9.1/gems/rspec-core-3.1.4/lib/rspec/core/example_group.rb:496:in `map'
# /var/lib/gems/1.9.1/gems/rspec-core-3.1.4/lib/rspec/core/example_group.rb:496:in `run_examples'
# /var/lib/gems/1.9.1/gems/rspec-core-3.1.4/lib/rspec/core/example_group.rb:463:in `run'
# /var/lib/gems/1.9.1/gems/rspec-core-3.1.4/lib/rspec/core/runner.rb:111:in `block (2 levels) in run_specs'
# /var/lib/gems/1.9.1/gems/rspec-core-3.1.4/lib/rspec/core/runner.rb:111:in `map'
# /var/lib/gems/1.9.1/gems/rspec-core-3.1.4/lib/rspec/core/runner.rb:111:in `block in run_specs'
# /var/lib/gems/1.9.1/gems/rspec-core-3.1.4/lib/rspec/core/reporter.rb:53:in `report'
# /var/lib/gems/1.9.1/gems/rspec-core-3.1.4/lib/rspec/core/runner.rb:107:in `run_specs'
# /var/lib/gems/1.9.1/gems/rspec-core-3.1.4/lib/rspec/core/runner.rb:85:in `run'
# /var/lib/gems/1.9.1/gems/rspec-core-3.1.4/lib/rspec/core/runner.rb:69:in `run'
# /var/lib/gems/1.9.1/gems/rspec-core-3.1.4/lib/rspec/core/runner.rb:37:in `invoke'
# /var/lib/gems/1.9.1/gems/rspec-core-3.1.4/exe/rspec:4:in `<top (required)>'
# /usr/local/bin/rspec:23:in `load'
# /usr/local/bin/rspec:23:in `<main>'
#
# Showing full backtrace because every line was filtered out.
# See docs for RSpec::Configuration#backtrace_exclusion_patterns and
# RSpec::Configuration#backtrace_inclusion_patterns for more information.
Edit: Here is an example of one of the spec files, however, the issue comes up on about 20 spec files. I know my solutions are correct and my peers aren't having the same issues I am:
first_name = "M"
last_name = "R"
age = 23
describe 'first_name' do
it "is defined as a local variable" do
expect(defined?(first_name)).to eq 'local-variable'
end
it "is a String" do
expect(first_name).to be_a String
end
end
describe 'last_name' do
it "is defined as a local variable" do
expect(defined?(last_name)).to eq 'local-variable'
end
it "be a String" do
expect(last_name).to be_a String
end
end
describe 'age' do
it "is defined as a local variable" do
expect(defined?(age)).to eq 'local-variable'
end
it "is an integer" do
expect(age).to be_a Fixnum
end
end

Ruby and Https: A socket operation was attempted to an unreachable network

I'm trying to download all of my class notes from coursera. I figured that since I'm learning ruby this would be a good practice exercise, downloading all the PDFs they have for future use. Unfortunately though, I'm getting an exception saying ruby can't connect for some reason. Here is my code:
require 'net/http'
module Coursera
class Downloader
attr_accessor :page_url
attr_accessor :destination_directory
attr_accessor :cookie
def initialize(page_url,dest,cookie)
#page_url=page_url
#destination_directory = dest
#cookie=cookie
end
def download
puts #page_url
request = Net::HTTP::Get.new(#page_url)
puts #cookie.encoding
request['Cookie']=#cookie
# the line below is where the exception is thrown
res = Net::HTTP.start(#page_url.hostname, use_ssl=true,#page_url.port) {|http|
http.request(request)
}
html_page = res.body
pattern = /http[^\"]+\.pdf/
i=0
while (match = pattern.match(html_page,i)) != nil do
# 0 is the entire string.
url_string = match[0]
# make sure that 'i' is updated
i = match.begin(0)+1
# we want just the name of the file.
j = url_string.rindex("/")
filename = url_string[j+1..url_string.length]
destination = #destination_directory+"\\"+filename
# I want to download that resource to that file.
uri = URI(url_string)
res = Net::HTTP.get_response(uri)
# write that body to the file
f=File.new(destination,mode="w")
f.print(res.body)
end
end
end
end
page_url_string = 'https://class.coursera.org/datasci-002/lecture'
puts page_url_string.encoding
dest='C:\\Users\\michael\\training material\\data_science'
page_url=URI(page_url_string)
# I copied this from my browsers developer tools, I'm omitting it since
# it's long and has my session key in it
cookie="..."
downloader = Coursera::Downloader.new(page_url,dest,cookie)
downloader.download
At runtime the following is written to console:
Fast Debugger (ruby-debug-ide 0.4.22, debase 0.0.9) listens on 127.0.0.1:65485
UTF-8
https://class.coursera.org/datasci-002/lecture
UTF-8
Uncaught exception: A socket operation was attempted to an unreachable network. - connect(2)
C:/Ruby200-x64/lib/ruby/2.0.0/net/http.rb:878:in `initialize'
C:/Ruby200-x64/lib/ruby/2.0.0/net/http.rb:878:in `open'
C:/Ruby200-x64/lib/ruby/2.0.0/net/http.rb:878:in `block in connect'
C:/Ruby200-x64/lib/ruby/2.0.0/timeout.rb:52:in `timeout'
C:/Ruby200-x64/lib/ruby/2.0.0/net/http.rb:877:in `connect'
C:/Ruby200-x64/lib/ruby/2.0.0/net/http.rb:862:in `do_start'
C:/Ruby200-x64/lib/ruby/2.0.0/net/http.rb:851:in `start'
C:/Ruby200-x64/lib/ruby/2.0.0/net/http.rb:582:in `start'
C:/Users/michael/Documents/Aptana Studio 3 Workspace/practice/CourseraDownloader.rb:20:in `download'
C:/Users/michael/Documents/Aptana Studio 3 Workspace/practice/CourseraDownloader.rb:52:in `<top (required)>'
C:/Ruby200-x64/bin/rdebug-ide:23:in `load'
C:/Ruby200-x64/bin/rdebug-ide:23:in `<main>'
C:/Ruby200-x64/lib/ruby/2.0.0/net/http.rb:878:in `initialize': A socket operation was attempted to an unreachable network. - connect(2) (Errno::ENETUNREACH)
from C:/Ruby200-x64/lib/ruby/2.0.0/net/http.rb:878:in `open'
from C:/Ruby200-x64/lib/ruby/2.0.0/net/http.rb:878:in `block in connect'
from C:/Ruby200-x64/lib/ruby/2.0.0/timeout.rb:52:in `timeout'
from C:/Ruby200-x64/lib/ruby/2.0.0/net/http.rb:877:in `connect'
from C:/Ruby200-x64/lib/ruby/2.0.0/net/http.rb:862:in `do_start'
from C:/Ruby200-x64/lib/ruby/2.0.0/net/http.rb:851:in `start'
from C:/Ruby200-x64/lib/ruby/2.0.0/net/http.rb:582:in `start'
from C:/Users/michael/Documents/Aptana Studio 3 Workspace/practice/CourseraDownloader.rb:20:in `download'
from C:/Users/michael/Documents/Aptana Studio 3 Workspace/practice/CourseraDownloader.rb:52:in `<top (required)>'
from C:/Ruby200-x64/lib/ruby/gems/2.0.0/gems/ruby-debug-ide-0.4.22/lib/ruby-debug-ide.rb:86:in `debug_load'
from C:/Ruby200-x64/lib/ruby/gems/2.0.0/gems/ruby-debug-ide-0.4.22/lib/ruby-debug-ide.rb:86:in `debug_program'
from C:/Ruby200-x64/lib/ruby/gems/2.0.0/gems/ruby-debug-ide-0.4.22/bin/rdebug-ide:110:in `<top (required)>'
from C:/Ruby200-x64/bin/rdebug-ide:23:in `load'
from C:/Ruby200-x64/bin/rdebug-ide:23:in `<main>'
I was following instructions here to write all the HTTP code. As far as I can see I'm following them ver-batim.
I'm using Windows 7, ruby 2.0.0p481, and Aptana Studio 3. When I copy the url into my browser it goes straight to the page without a problem. When I look at the request headers in my browser for that url, I don't see anything else I think I'm missing. I also tried setting the Host and Referer request headers, it made no difference.
I am out of ideas, and have already searched Stack Overflow for similar questions but that didn't help. Please let me know what I'm missing.
So, I had this same error message with a different project and the problem was that my machine literally couldn't connect to the IP / Port. Have you tried connecting with curl? If it works in your browser, it could be using a proxy or something to actually get there. Testing the URL with curl solved the problem for me.

Performing a BLAST search with BioRuby

I am attempting to perform a BLAST search using BioRuby on a Windows XP machine with Ruby 1.9.3 and BioRuby 1.4.3_0001. I have installed the necessary dependencies, e.g., cairo, but the output is as follows:
C:/Ruby193/lib/ruby/site_ruby/1.9.1/rubygems/core_ext/kernel_require.rb:45:in `r
equire': cannot load such file -- cairo.so (LoadError)
from C:/Ruby193/lib/ruby/site_ruby/1.9.1/rubygems/core_ext/kernel_requir
e.rb:45:in `require'
from C:/Ruby193/lib/ruby/gems/1.9.1/gems/cairo-1.12.6-x86-mingw32/lib/ca
iro.rb:46:in `rescue in <top (required)>'
from C:/Ruby193/lib/ruby/gems/1.9.1/gems/cairo-1.12.6-x86-mingw32/lib/ca
iro.rb:42:in `<top (required)>'
from C:/Ruby193/lib/ruby/site_ruby/1.9.1/rubygems/core_ext/kernel_requir
e.rb:110:in `require'
from C:/Ruby193/lib/ruby/site_ruby/1.9.1/rubygems/core_ext/kernel_requir
e.rb:110:in `rescue in require'
from C:/Ruby193/lib/ruby/site_ruby/1.9.1/rubygems/core_ext/kernel_requir
e.rb:35:in `require'
from C:/Ruby193/lib/ruby/gems/1.9.1/gems/bio-graphics-1.4/lib/bio-graphi
cs.rb:11:in `<top (required)>'
from C:/Ruby193/lib/ruby/site_ruby/1.9.1/rubygems/core_ext/kernel_requir
e.rb:110:in `require'
from C:/Ruby193/lib/ruby/site_ruby/1.9.1/rubygems/core_ext/kernel_requir
e.rb:110:in `rescue in require'
from C:/Ruby193/lib/ruby/site_ruby/1.9.1/rubygems/core_ext/kernel_requir
e.rb:35:in `require'
from bio283.rb:2:in `<main>'
The sample code I am using is as follows:
require 'bio'
require 'bio-graphics'
remote_blast_factory = Bio::Blast.remote('blastp', 'swissprot',
'-e 0.0001', 'genomenet')
seq = Bio::Sequence::AA.new('MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGE')
# run the actual BLAST by querying the factory
report = remote_blast_factory.query(seq)
# Then, to parse the report, see Bio::Blast::Report
report.each do |hit|
puts hit.evalue # E-value
puts hit.sw # Smith-Waterman score (*)
puts hit.identity # % identity
puts hit.overlap # length of overlapping region
puts hit.query_id # identifier of query sequence
puts hit.query_def # definition(comment line) of query sequence
puts hit.query_len # length of query sequence
puts hit.query_seq # sequence of homologous region
puts hit.target_id # identifier of hit sequence
puts hit.target_def # definition(comment line) of hit sequence
puts hit.target_len # length of hit sequence
puts hit.target_seq # hit of homologous region of hit sequence
puts hit.query_start # start position of homologous
# region in query sequence
puts hit.query_end # end position of homologous region
# in query sequence
puts hit.target_start # start position of homologous region
# in hit(target) sequence
puts hit.target_end # end position of homologous region
# in hit(target) sequence
puts hit.lap_at # array of above four numbers
end
Could someone explain why the problem is occurring? I noticed the file name 'cairo.so' in the output. Could that relate to a linux/unix op. sys?
Thanks,
Caitlin
One of the libraries you installed depends on cairo. You have to install it. The .so extension is a Ruby library written in C, used in Unix. In Windows, you need a corresponding .dll file installed.

IOError: closed stream in Ruby SFTP

The following code tries to list the entries of a remote directory via SFTP and Net::SFTP, but it causes an "closed stream" IOError if the directory contains a large number of files (~ 6000 files):
require 'net/ssh'
require 'net/sftp'
Net::SFTP.start('hostname', 'username', :password => 'password') do |sftp|
# list the entries in a directory
sftp.dir.foreach("/") do |entry|
puts entry.longname
end
end
What is the best way to avoid it? Versions are net-sftp Gem: 2.0.5 and net-ssh Gem: 2.2.1, Ruby: 1.8.7. The full error message reads:
IOError: closed stream
from ~/.rvm/gems/ruby-1.8.7-p330/gems/net-ssh-2.2.1/lib/net/ssh/ruby_compat.rb:33:in `select'
from ~/.rvm/gems/ruby-1.8.7-p330/gems/net-ssh-2.2.1/lib/net/ssh/ruby_compat.rb:33:in `io_select'
from ~/.rvm/gems/ruby-1.8.7-p330/gems/net-ssh-2.2.1/lib/net/ssh/ruby_compat.rb:32:in `synchronize'
from ~/.rvm/gems/ruby-1.8.7-p330/gems/net-ssh-2.2.1/lib/net/ssh/ruby_compat.rb:32:in `io_select'
from ~/.rvm/gems/ruby-1.8.7-p330/gems/net-ssh-2.2.1/lib/net/ssh/transport/packet_stream.rb:73:in `available_for_read?'
from ~/.rvm/gems/ruby-1.8.7-p330/gems/net-ssh-2.2.1/lib/net/ssh/transport/packet_stream.rb:85:in `next_packet'
from ~/.rvm/gems/ruby-1.8.7-p330/gems/net-ssh-2.2.1/lib/net/ssh/transport/session.rb:170:in `poll_message'
from ~/.rvm/gems/ruby-1.8.7-p330/gems/net-ssh-2.2.1/lib/net/ssh/transport/session.rb:165:in `loop'
from ~/.rvm/gems/ruby-1.8.7-p330/gems/net-ssh-2.2.1/lib/net/ssh/transport/session.rb:165:in `poll_message'
from ~/.rvm/gems/ruby-1.8.7-p330/gems/net-ssh-2.2.1/lib/net/ssh/connection/session.rb:451:in `dispatch_incoming_packets'
from ~/.rvm/gems/ruby-1.8.7-p330/gems/net-ssh-2.2.1/lib/net/ssh/connection/session.rb:213:in `preprocess'
from ~/.rvm/gems/ruby-1.8.7-p330/gems/net-ssh-2.2.1/lib/net/ssh/connection/session.rb:197:in `process'
from ~/.rvm/gems/ruby-1.8.7-p330/gems/net-ssh-2.2.1/lib/net/ssh/connection/session.rb:161:in `loop'
from ~/.rvm/gems/ruby-1.8.7-p330/gems/net-ssh-2.2.1/lib/net/ssh/connection/session.rb:161:in `loop_forever'
from ~/.rvm/gems/ruby-1.8.7-p330/gems/net-ssh-2.2.1/lib/net/ssh/connection/session.rb:161:in `loop'
from ~/.rvm/gems/ruby-1.8.7-p330/gems/net-ssh-2.2.1/lib/net/ssh/connection/session.rb:110:in `close'
from ~/.rvm/gems/ruby-1.8.7-p330/gems/net-sftp-2.0.5/lib/net/sftp.rb:36:in `start'
The behavior could be deliberate, if we take a look at the dir source code in net-sftp/lib/net/sftp/operations/dir.rb, we see a close operation:
def foreach(path)
..
ensure
sftp.close!(handle) if handle
end
It is possible that this close operation causes the closed stream error. If it does not indicate a bug, it is possible the catch the IOError exception. It also seems to help to run the SSH event loop occasionally:
begin
..
sftp.dir.foreach("/") do |entry|
puts entry.longname
# ...
sftp.loop # Runs the SSH event loop
end
rescue IOError => Ex
puts "*** We are done: "+Ex.message
end

Sequel gem: Handling invalid date values gracefully

I'm a ruby noob and I'm trying to process some blog posts using Sequel and the data_objects adapter:
DB = Sequel.connect('do:mysql://user:pass#localhost/database')
db[posts_query].each do |post|
puts post
end
But I get Sequel::InvalidValue exception, complaining about the date column:
/usr/lib/ruby/1.9.1/time.rb:202:in `local': ArgumentError: argument out of range (Sequel::InvalidValue)
from /usr/lib/ruby/1.9.1/time.rb:202:in `make_time'
from /usr/lib/ruby/1.9.1/time.rb:271:in `parse'
from /var/lib/gems/1.9.1/gems/sequel-3.42.0/lib/sequel/core.rb:295:in `string_to_datetime'
I tried to catch the exception:
begin
db[posts_query].each do |post|
puts post
end
rescue Sequel::InvalidValue => e
puts e.inspect
end
but that doesn't help much.
How can I find out which row has the incorrect value?
Also, is there a way to do this iteration, such that I can catch the exception but continue to loop over the remaining rows?
Update:
I switched to the mysql2 adapter and now I can at least see the invalid date:
/var/lib/gems/1.9.1/gems/sequel-3.42.0/lib/sequel/adapters/mysql2.rb:154:in `each': Mysql2::Error: Invalid date: 2008-04-00 00:00:15 (Sequel::DatabaseError)
from /var/lib/gems/1.9.1/gems/sequel-3.42.0/lib/sequel/adapters/mysql2.rb:154:in `block in fetch_rows'
from /var/lib/gems/1.9.1/gems/sequel-3.42.0/lib/sequel/adapters/mysql2.rb:89:in `_execute'
from /var/lib/gems/1.9.1/gems/sequel-3.42.0/lib/sequel/adapters/shared/mysql_prepared_statements.rb:34:in `block in execute'
from /var/lib/gems/1.9.1/gems/sequel-3.42.0/lib/sequel/database/connecting.rb:236:in `block in synchronize'
from /var/lib/gems/1.9.1/gems/sequel-3.42.0/lib/sequel/connection_pool/threaded.rb:104:in `hold'
from /var/lib/gems/1.9.1/gems/sequel-3.42.0/lib/sequel/database/connecting.rb:236:in `synchronize'
from /var/lib/gems/1.9.1/gems/sequel-3.42.0/lib/sequel/adapters/shared/mysql_prepared_statements.rb:34:in `execute'
from /var/lib/gems/1.9.1/gems/sequel-3.42.0/lib/sequel/dataset/actions.rb:778:in `execute'
from /var/lib/gems/1.9.1/gems/sequel-3.42.0/lib/sequel/adapters/mysql2.rb:171:in `execute'
from /var/lib/gems/1.9.1/gems/sequel-3.42.0/lib/sequel/adapters/mysql2.rb:140:in `fetch_rows'
from /var/lib/gems/1.9.1/gems/sequel-3.42.0/lib/sequel/dataset/actions.rb:154:in `each'
from wordpress_importer.rb:112:in `process'
from wordpress_importer.rb:308:in `<main>'
Can you post more of the backtrace? You need to see what is calling string_to_datetime.
Also, I would recommend against using the do/mysql adapter unless you have specific needs that require it. Use the mysql or mysql2 adapter instead. If the error is being caused by bogus datetimes in your MySQL database, then you may want to use the mysql2 adapter or use the mysql adapter and set DB.convert_invalid_date_time = nil.

Resources